PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA751G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 198aa    MW: 21247.2 Da    PI: 6.7948
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA751G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.93.1e-5826121297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyv+plkvyl+++re+ege+
  AA751G00004  26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVDPLKVYLQRFREIEGER 121
                  89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-5420129IPR009072Histone-fold
SuperFamilySSF471131.71E-4128151IPR009072Histone-fold
PfamPF008081.3E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-205977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-207896No hitNo description
PRINTSPR006154.2E-2097115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGDSDRDSGG GPNGNNHNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ  60
ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVDPLKVY LQRFREIEGE  120
RTGLGRPQTG GDSSDHQRDA VNDGGGGNSG MGFYGGGMQY HQHHQFLQQQ NHMYGPSGGS  180
GNGNGSGGGG ATSGRTRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4826116292Transcription factor HapC (Eurofung)
4g92_B1e-4826116292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013697087.11e-98PREDICTED: nuclear transcription factor Y subunit B-2-like
SwissprotQ9FGJ39e-87NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBLA0A078HTQ14e-93A0A078HTQ1_BRANA; BnaA09g18400D protein
TrEMBLM4DLU24e-93M4DLU2_BRARP; Uncharacterized protein
TrEMBLW6DGI74e-93W6DGI7_BRANA; BnaC09g20320D protein
STRINGBra017473.1-P1e-92(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.19e-87nuclear factor Y, subunit B2